PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp5g16140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 200aa    MW: 22395.2 Da    PI: 7.9968
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp5g16140genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.61.5e-17126160135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                C +Cgt +TplWR+gp g+ tLCnaCG++yr  +l
  Tp5g16140 126 CLHCGTRNTPLWREGPKGPGTLCNACGMRYRTGRL 160
                99*****************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004015.6E-13120174IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.95E-14123182No hitNo description
Gene3DG3DSA:3.30.50.107.3E-15124157IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.42E-16125174No hitNo description
PfamPF003202.5E-15126160IPR000679Zinc finger, GATA-type
PROSITE patternPS003440126151IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.453126156IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MEHKDVVVEE DLGTAIQNLE IPFTELEQNA FGFTDDGLGG IKEIIEDSNL LCYDSQELEN  60
SSHDVSIDDS VELKSFISSS DSPTALRGTS RVTKRPRNKR GRKKRACFNS PACLFESKVD  120
VTEKICLHCG TRNTPLWREG PKGPGTLCNA CGMRYRTGRL LPEYCPASSP NFKPNVHSNF  180
HRKVMKIRGN KNSPANNSWF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00391DAPTransfer from AT3G45170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006419066.12e-71hypothetical protein EUTSA_v10002799mg
SwissprotQ9M1U21e-69GAT14_ARATH; GATA transcription factor 14
TrEMBLV4L5F02e-71V4L5F0_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0005_12701e-68(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM163681113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G45170.19e-64GATA transcription factor 14